PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_20241A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family EIL
Protein Properties Length: 474aa    MW: 53105.3 Da    PI: 5.4027
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_20241AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3181.58e-56381681137
                                XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                       EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpv 84 
                                +el +rmwkd+++lkr+ker++ l  ++ +  ++k+ nk ++qa rkkm+raQDgi+kYMlk mevcna+GfvYgiipekgkpv
  Oropetium_20150105_20241A  38 DELARRMWKDKVKLKRIKERQQMLAMQRLE-EKSKTMNKLSDQALRKKMARAQDGIIKYMLKLMEVCNARGFVYGIIPEKGKPV 120
                                79*******************997655555.788899*********************************************** PP

                                XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----ST CS
                       EIN3  85 egasdsLraWWkekvefdrngpaaiskyqaknlilsgesslqtersseshsls 137
                                +gasd+Lr+WWkekv+fd+ngpaai+ky+ +n +l++++s++t+     hs+s
  Oropetium_20150105_20241A 121 SGASDNLREWWKEKVKFDKNGPAAIAKYELENSVLANAKSKTTH-----HSIS 168
                                ************************************99988554.....4443 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048739.9E-5538169No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042762Biological Processregulation of sulfur metabolic process
GO:0071281Biological Processcellular response to iron ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 474 aa     Download sequence    Send to blast
MDHLTMLASE LGDVSDFEVD GIKNLSENDV SDEEIDADEL ARRMWKDKVK LKRIKERQQM  60
LAMQRLEEKS KTMNKLSDQA LRKKMARAQD GIIKYMLKLM EVCNARGFVY GIIPEKGKPV  120
SGASDNLREW WKEKVKFDKN GPAAIAKYEL ENSVLANAKS KTTHHSISLD RNADISSRND  180
EYKVDRLEEP PRSMSSRDDD EDPKPLLQIR EETSSRGNRR KRNEETDKTR KRNEETDKPR  240
KRKIPQGPSM VAEHEIEVTQ RNDNLPEALR NYIHDMNRFN EIGMFSHSST TGASQQQGMQ  300
GSLQGNLLSR GAVIDNYNGN QTANATQSSI HLKGDQPVAC ESSDIANSWS ANSFQQGAVN  360
GPIGFNPSSV VHQTSLMQQS LPIPMNYQAP IMETGMLPES TSYSHHMSGS VNSSAVADQT  420
HRFMDDTSYS DPVDKFVGGP FGGLPLDFFP TTSPIPAIDE LLDDDDLMQY LGT*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00233DAPTransfer from AT1G73730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002445904.11e-87hypothetical protein SORBIDRAFT_07g027790
TrEMBLC5YIS71e-87C5YIS7_SORBI; Putative uncharacterized protein Sb07g027790
STRINGSb07g027790.14e-87(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37203779
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.15e-60ETHYLENE-INSENSITIVE3-like 3